PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA10G00493
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family B3
Protein Properties Length: 300aa    MW: 34106.7 Da    PI: 5.143
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA10G00493genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3505.4e-16421231297
                 HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
          B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                 +s  + +p ++ e+ +  ++ ++t +l+ + g sW+vk+   + ++++++++GW++Fv++n+Lk  + ++F +dg ++fe ++  +
  AA10G00493  42 NSTSMLIPMSYYEHLS--PQMKTTAILQGSGGCSWKVKI--VRMDEEVYFGQGWEKFVEDNHLKGMEYLTFVYDGVHTFEVTIYGR 123
                 456699******5554..345579***************..9999*****************************999997666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.78831124IPR003340B3 DNA binding domain
SMARTSM010192.4E-1133124IPR003340B3 DNA binding domain
CDDcd100176.55E-1338121No hitNo description
SuperFamilySSF1019362.55E-1941126IPR015300DNA-binding pseudobarrel domain
PfamPF023626.7E-1442123IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.9E-1844126IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MLPESSSSDL VKSGMEVTVF TPSPMASNFL PRFSRAFDSI INSTSMLIPM SYYEHLSPQM  60
KTTAILQGSG GCSWKVKIVR MDEEVYFGQG WEKFVEDNHL KGMEYLTFVY DGVHTFEVTI  120
YGRDGCKEIR AGIEVDTEED LHSVYSLSSS EEYKETRSAM DVDTEEDFVS DSVSEATATS  180
VESEMEIKST KGKTKISNPE TYLDDPNNLF FETKLKKNKY LLLVPSQLVK DYSLKFPDRI  240
DYIFKGGKLS ANIANSYIKR WNQVCEKIKV KKDDPILCEL LSTENVVHAI KIHVIRNKHA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1yel_A1e-143212610104At1g16640
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882451.12e-71transcriptional factor B3 family protein
TrEMBLD7L4S82e-71D7L4S8_ARALL; Transcriptional factor B3 family protein
STRINGfgenesh1_pm.C_scaffold_30004945e-71(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15612380
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06160.13e-69B3 family protein